General Information

  • ID:  hor003845
  • Uniprot ID:  Q9YGK4
  • Protein name:  Lipotropin beta
  • Gene name:  pomca
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ELATNEIDYPQEEGALNQQDKKDGSYKMSHFRWSSPPASKRYGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ
  • Length:  74
  • Propeptide:  MVRGERMLCPAWLLALAVLCAAGSEVRAQCMEDARCRDLTTDENILDCIQLCRSDLTDETPVYPGESHLQPPSELEQTEVLVPLSPAALAPAEQMDPESSPQHEHKRSYSMEHFRWGKPVGRKRRPIKVYTNGVEEESTETLPAEMRRELATNEIDYPQEEGALNQQDKKDGSYKMSHFRWSSPPASKRYGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ
  • Signal peptide:  MVRGERMLCPAWLLALAVLCAAGSEVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9YGK4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003845_AF2.pdbhor003845_ESM.pdb

Physical Information

Mass: 1001897 Formula: C385H593N109O119S2
Absent amino acids: C Common amino acids: K
pI: 9.51 Basic residues: 15
Polar residues: 20 Hydrophobic residues: 16
Hydrophobicity: -139.59 Boman Index: -21723
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 44.86
Instability Index: 6561.35 Extinction Coefficient cystines: 15470
Absorbance 280nm: 211.92

Literature

  • PubMed ID:  9806347
  • Title:  Cloning and expression of two proopiomelanocortin mRNAs in the common carp (Cyprinus carpio L.).